PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07464.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 540aa    MW: 58708.9 Da    PI: 8.987
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07464.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind674.2e-21272331261
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                                   Fl+k+++++++++l+ +isw + gns+vv+d+++fa++vLp +Fkh+nf+ FvRQLn+Y 
  Zmw_sc07464.1.g00010.1.am.mk 272 FLSKTFDLVSEPALDGVISWGAAGNSIVVWDPSTFARDVLPYHFKHNNFSTFVRQLNTYS 331
                                   9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.1E-22266331IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.7E-25268373IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.03E-20268331IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004473.9E-18272331IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.6E-10272295IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.6E-10310322IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.6E-10323335IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MFTAADATFA TPTKGTEPVR HKTATTTITL GYADVAQRTI QPIRVRLPSL PVPYMRTPRV  60
PTANARARPK ISRPLFAAKQ NPPPAAGLVS GGLACCSFHP ARYIYRPSPL LLASTASPSG  120
QIPGGPRLDH PPTPRSTIAS ACHLTPGLSP AGTLAVHADR RPPHITVCRF DPKPINAPPP  180
RPSPPISSSG SRPRKVPSHA VAMNRDRANA PEYPTSSASM EALLEPKLED EAALPLSSPG  240
PLVPLDQLMP GPGLDPPRPL EALLQGPQLP PFLSKTFDLV SEPALDGVIS WGAAGNSIVV  300
WDPSTFARDV LPYHFKHNNF STFVRQLNTY SRGVDPVTGK LNPCHGMPRS SSLDPEHTLR  360
REKTALLQEV TRLKQEHRQT IEHMSTLNQR LESADDRQKQ MISFLAKLLQ NPTFVRQLKL  420
QREQKEIDST RVKRKYLKHV PHGSIESGLD ATSSEAACLA SLGENMGLLS GTMLEPAAND  480
EQLWGIDTSA ALQSSCSGSS QQAYSSLASD PYLMEIVNKP EKFWDPDFQP LDEGDLPLDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A9e-162643301178Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147968.11e-104heat shock factor protein 2
RefseqXP_004952622.11e-104PREDICTED: heat stress transcription factor A-3-like
SwissprotQ6H6Q71e-101HSFA3_ORYSJ; Heat stress transcription factor A-3
TrEMBLB6SWQ21e-104B6SWQ2_MAIZE; Heat shock factor protein 2
TrEMBLK3YRP91e-104K3YRP9_SETIT; Uncharacterized protein
STRINGSi016943m1e-103(Setaria italica)
STRINGGRMZM2G059851_P011e-103(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90103041